DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and mthl10

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster


Alignment Length:613 Identity:118/613 - (19%)
Similarity:194/613 - (31%) Gaps:207/613 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PSAPTAGTFESKSMLEPTSSHSLATGRVPLLHDFDASTTES-----PGTYVLDGVARVAQLALEP 161
            |..|    |.:..|.|....|::....|| .:.:|......     .|:|...|....|:|.   
  Fly    31 PGIP----FGTYVMAERDHYHTIDDPNVP-CNFYDTVNLTGHRLFPNGSYDYYGTIVPAELV--- 87

  Fly   162 TVMDALPDSDTEQV-------------LGNLNSSAPW-----------------NLTLASAAATN 196
            ...|.:..|.||::             ...||...||                 |.|.......|
  Fly    88 GTYDYIHSSLTERIEVREHVRGCVCKFKSCLNICCPWRQVFNSEVDGCIIDHSDNRTWPDPPMLN 152

  Fly   197 --FENCSALFVN----------------YTL-PQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGG 242
              |.|.|.:.||                ::| |:|.     .||..|.:   ..|.:.|::    
  Fly   153 ITFRNESTILVNMFTQFAIQSFRPCPKMFSLQPETN-----NWDDYLLF---ENGSMLRVD---- 205

  Fly   243 FHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIAR 307
                  .|..|||.|.                       |..|..:. ...|......|..|:..
  Fly   206 ------DKLLIRKNEF-----------------------CMVPTYVN-ESDMFYTIHPANCDMQD 240

  Fly   308 RTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMV-LQVIIRLTLYLDQFRRGN 371
            ...|::|:.....:|::...:|....:..:...|.:..|:|...:: |.|......|:..:    
  Fly   241 DHSTVKIINSYAMMFSIPFMMLTIAVYLLIPELRNQHGKSLVCYLIGLSVGYSSLCYVQLY---- 301

  Fly   372 KEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYL-HNMVTVAVFQGS-----FPL 430
            :..||..:..|...|.|          :.....:||:.:....| ||      |:|:     |..
  Fly   302 QVDATGVTCKVFGYTAY----------FFFMGAYMWLSVISFDLWHN------FRGTRGINRFQE 350

  Fly   431 K----FFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNY--NLTP------YYWI-------- 475
            |    |:|...|.:.:          |....|...:.|.|.  ||.|      |.|:        
  Fly   351 KKRFLFYSLYSWGIAL----------VFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAM 405

  Fly   476 --LEGPRLAVILLN-FCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAA----------------- 520
              ..||.||:::.| ..|::..|::..::...::....|.:.|.:|..                 
  Fly   406 IYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKRFYRAWSNYRFGLF 470

  Fly   521 IVLLPLLGITNLLHQLAPLKTATNFAV-----WS---YGTHFLTSFQGFFIALIYCFLNGEVRAV 577
            :.|..::|||.|...:       ::.|     ||   |.:....:.|||.|.:::      |...
  Fly   471 LRLFLIMGITWLTELI-------SYFVGSDKGWSKLFYISDLANAMQGFLIFMLF------VMKK 522

  Fly   578 LLKSLATQ--LSVRGHPEWAPKRASMYS 603
            .:|.|.|.  .|||   :.:.:|.|.||
  Fly   523 KVKHLITNRCSSVR---DGSNQRQSQYS 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 10/58 (17%)
7tm_4 306..563 CDD:304433 58/311 (19%)
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145 39/224 (17%)
7tm_4 244..514 CDD:304433 58/306 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.