DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and Cirl

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster


Alignment Length:516 Identity:111/516 - (21%)
Similarity:174/516 - (33%) Gaps:186/516 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 YIDIA--------RRTRTLEIVGLC--LSLFALIVSLL------IFCTFRSLRNNRTKIHKNLFV 350
            |||.|        ..|.....|..|  |:.||:::.::      :|..|..  |.|..|:.::.:
  Fly   714 YIDHAWSANGCSLESTNRTHSVCSCNHLTNFAILMDVVDEHQHSLFTMFDG--NMRIFIYISIGI 776

  Fly   351 AMVLQVIIRLTLYLDQFRRGN----KEAATNTSLSVIENTPYLC----EASYVL-LEYARTAMFM 406
            .:|..||..|||.|     .|    |.|.|:...|:     |||    |..::| :|...|::|.
  Fly   777 CVVFIVIALLTLKL-----FNGVFVKSARTSIYTSI-----YLCLLAIELLFLLGIEQTETSIFC 831

  Fly   407 WMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSL--GECLWNYNL 469
            . ||. ::||                      |. ||..|.|......:..::|  .|.|...:.
  Fly   832 G-FIT-IFLH----------------------CA-ILSGTAWFCYEAFHSYSTLTSDELLLEVDQ 871

  Fly   470 TP----YYWILEGPRLAVILL------------NFCFLVN---------IIRVLV---------- 499
            ||    ||.:..|..|:|:.:            ::|.|:.         :|.|||          
  Fly   872 TPKVNCYYLLSYGLSLSVVAISLVIDPSTYTQNDYCVLMEANALFYATFVIPVLVFFVAAIGYTF 936

  Fly   500 ----MKLRQSQA--SDIEQTRKA-----VRAAIVLLPLLGITNLLHQLAPLKTATNFAVWS---- 549
                :..|:|:.  ...|.||.|     :|.:.|.|.||.                 |||.    
  Fly   937 LSWIIMCRKSRTGLKTKEHTRLASVRFDIRCSFVFLLLLS-----------------AVWCSAYF 984

  Fly   550 --------------YGTHFL--TSFQGFFIALIYCFLNGEVRAVLLKSLATQLSVRGHPEWAPK- 597
                          ||..|:  .:..|.:|.:.:|..|.::|....|      .||.| .|.|| 
  Fly   985 YLRGAKMDDDTADVYGYCFICFNTLLGLYIFVFHCIQNEKIRREYRK------YVRQH-AWLPKC 1042

  Fly   598 ----RASMYSGAYN----TAPDTDAVQPAGDP----SATGKRISPPNKRLNGRKPSSASIVM--- 647
                :.|:.||...    ||....:|..:..|    ..:.:....|.::.....|.:...:|   
  Fly  1043 LRCSKTSISSGIVTGNGPTAGTLCSVSTSKKPKLPLGVSEEAHDDPQQQQQTPVPITEDAIMGAT 1107

  Fly   648 ----IHEPQQRQRLMPRLQNKAREKGKDRVEKTDAEAEPDPTISHIHSKEAGSARSRTRGS 704
                ::|.|||:.|            |..:.....:|.|.....|:..:...:.||....|
  Fly  1108 SDCELNEAQQRRTL------------KSGLMTGTLQAPPQTLGGHVVLERGSTLRSTGHAS 1156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888
7tm_4 306..563 CDD:304433 75/349 (21%)
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639 10/37 (27%)
7tm_4 763..1014 CDD:304433 66/304 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.