DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and mthl1

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster


Alignment Length:479 Identity:95/479 - (19%)
Similarity:162/479 - (33%) Gaps:144/479 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LFVNYTL--------PQTGLYCNWTWD-TLLCW-----------PPTPAGVLARMNCPGGFHGVD 247
            ||.|.||        .|...|| ..|: .::|.           |...|..|.:...|       
  Fly   133 LFPNGTLYVRERALMVQPSDYC-VDWEVAVVCLNDSQPINALEDPDYAANPLVQQEPP------- 189

  Fly   248 TRKFAIRKCELDGRWGS----------RPN----------ATEVNPPG--WTDYG--PCYKP--- 285
              |.::|..:..|:|||          :||          .:...|.|  .|.||  .|.:|   
  Fly   190 --KASLRLSKCCGKWGSYNTQLQNCDLQPNHQAAVDGLLRLSPQLPEGSYQTSYGLPDCGQPGGY 252

  Fly   286 ---------EIIR--LMQQMGSKDFDA---YIDIARRTRTLEIVGLCLSLF-----ALIVSLLIF 331
                     ::.|  .|.|:..|:..|   .::..:|...::|:. |..||     |.|....|.
  Fly   253 SIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIA-CQHLFSSAAGAGIHDGSIG 316

  Fly   332 CTFRSLRNNRTKIHKNLFVAMVLQVIIRLT----------------------LYLDQFRRGNKEA 374
            .|..  :.|...:.|.:....:|..|:.|:                      .|:.....|....
  Fly   317 GTIE--QANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKILL 379

  Fly   375 ATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVF--------------Q 425
            |.....|.::.....|....:.:::...|.|.|:        |.:...::              |
  Fly   380 AIEELSSSLQPGSAACHTLAITMQFFFLAAFFWL--------NTMCFNIWWTFRDFRPSSLERNQ 436

  Fly   426 GSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSL-----GE--CLW----NYNLTPYYWILEGP 479
            .:.....:|...|..|:|:|.| |.|.....:|:|     |:  | |    |.::..|::   ||
  Fly   437 EALRRYLYSLYAWGGPLLITFV-AACVDQLPETTLLRPGFGQLYC-WFDNRNLSIFAYFY---GP 496

  Fly   480 RLAVILLNFCFLVNIIRVLVMKL--RQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTA 542
            ...::..|....|:....|...|  |....|..|::... |..:.|:.::|:|.:...|:.|...
  Fly   497 IGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALG-RVCLKLVVVMGVTWIADILSWLVGG 560

  Fly   543 TNFAVWSYGTHFLTSFQGFFIALI 566
            .: .||.: |..:.:.||.||.::
  Fly   561 PH-GVWFF-TDLINALQGVFIFIV 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 16/90 (18%)
7tm_4 306..563 CDD:304433 59/310 (19%)
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 49/265 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.