DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and CG15744

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_572870.2 Gene:CG15744 / 2768909 FlyBaseID:FBgn0030466 Length:1797 Species:Drosophila melanogaster


Alignment Length:521 Identity:98/521 - (18%)
Similarity:146/521 - (28%) Gaps:213/521 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EMERDQFSIAANACMSMGPMLISKDKAPCSGGRVRHADSLHIYYAVDGKMTLLSNILDCGG---- 81
            |:::|.|          |..|...:|...:|..:.     |||.....:|..| .:||..|    
  Fly   121 ELDKDTF----------GDSLAHLEKLKLAGNAIS-----HIYEGTFDQMPKL-KLLDLSGNPLA 169

  Fly    82 ---------CISAQRFTRLLRQSGSSGPSPSAPTAGTFESKSMLEPTSSHSLATGRVPLLHDFDA 137
                     ..|:.|..||       .|.|...:.|.|....:      ..|..|:     ||..
  Fly   170 CDCGLIWLIAWSSSREVRL-------QPPPKCESPGNFRGMPL------KKLRVGK-----DFHC 216

  Fly   138 STTESPGTYVLDGVARVAQLALE-----------------PTVMDALPD---------------- 169
            .|...|   :|:.:....|:|.|                 |...:.||.                
  Fly   217 ETLLQP---LLELIPSQNQVAFEGDELQLKCHAPRVAIGVPRESEDLPTKAYVFWGWSEKIRAKN 278

  Fly   170 -------SDTEQVLGNL------------------------NSSAPWNLTLASAAATNFENCSAL 203
                   .|..:|.|::                        |.:..|:.||.|..|    |.|..
  Fly   279 STEDIIYQDPTKVFGDVNLETRHSTDSGILQSILRIASLTQNHTGMWDCTLRSQQA----NLSQA 339

  Fly   204 FVNYTLPQTGLYCN----WTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGS 264
            .|.:.:.:..|||.    .|......||.|..|......|..........:.|..:|...|.|  
  Fly   340 IVLHVVAKGTLYCEARVVHTNKGTYHWPRTMRGETVLQECVEEPSDATQARRASHECGPSGEW-- 402

  Fly   265 RPNATEVNPPGWTDYGPC-YKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSL 328
                  :|    .|...| |..|..|:::|....:    :.:.:....|||.             
  Fly   403 ------LN----LDTESCVYVSETTRILEQFAKVN----LTLTKGQNALEIA------------- 440

  Fly   329 LIFCTFRSLRN---NRTKIHKNLFVAMVLQVIIR-LTLYLDQ----------------------- 366
                  |.|.|   .:|:::: :...|.|:.|.| |..||||                       
  Fly   441 ------RRLHNFTQAQTQLNR-IRDPMDLEYIARTLVKYLDQLEQPQQQQEISHLLMDIVSQLLN 498

  Fly   367 -----FRRGNKEAATNTSLSVIENTPYLCEASYVLLEYART-------AMFMW---------MFI 410
                 ||....|..|...|.      ::.|:|.:.|..|.|       .|..|         :|:
  Fly   499 LPAHLFRAAQSEQGTGQRLL------HVVESSAMRLALASTQAEPLPAEMIPWRGSLAQQRNLFV 557

  Fly   411 E 411
            |
  Fly   558 E 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 13/62 (21%)
7tm_4 306..563 CDD:304433 30/154 (19%)
CG15744NP_572870.2 LRR_8 107..168 CDD:290566 15/62 (24%)
LRR_4 107..147 CDD:289563 7/40 (18%)
leucine-rich repeat 109..133 CDD:275378 5/21 (24%)
leucine-rich repeat 134..157 CDD:275378 6/27 (22%)
LRRCT 166..216 CDD:214507 12/67 (18%)
IG_like 229..344 CDD:214653 18/118 (15%)
HRM <366..412 CDD:295297 12/57 (21%)
7tm_4 768..>975 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.