DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and GLP1R

DIOPT Version :10

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_002053.3 Gene:GLP1R / 2740 HGNCID:4324 Length:463 Species:Homo sapiens


Alignment Length:101 Identity:23/101 - (22%)
Similarity:42/101 - (41%) Gaps:16/101 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSIARASMMTPKASPKLAKYMEPVREEGQKKKKTRSMFSWLGGDSSKKKNKEVL---------ET 73
            |.:|.|:::   ..|.|...::..:::...||.|.:.|.....:|...:.|:.:         :.
Human    12 LGVASAAII---PEPTLDTEVQEQKDKEGLKKATWNEFVMKLNNSKNDQEKDGIDIELRVFFGQL 73

  Fly    74 VSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFD 109
            ..|.|.||......|:.|..|    ..|.:|||:|:
Human    74 TDEELMKIMTNIFHPMLEEEK----TQPVVDDPEFE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:397086
7tmB1_PDFR 306..584 CDD:320389
TM helix 1 308..333 CDD:320389
TM helix 2 342..364 CDD:320389
TM helix 3 391..418 CDD:320389
TM helix 4 430..450 CDD:320389
TM helix 5 469..498 CDD:320389
TM helix 6 512..539 CDD:320389
TM helix 7 546..571 CDD:320389
GLP1RNP_002053.3 HRM 60..128 CDD:397086 12/50 (24%)
7tmB1_GLP1R 141..419 CDD:341342
TM helix 1 143..168 CDD:341342
TM helix 2 177..199 CDD:341342
TM helix 3 227..254 CDD:341342
TM helix 4 266..286 CDD:341342
TM helix 5 302..331 CDD:341342
TM helix 6 345..372 CDD:341342
Important for allosteric inhibitor binding. /evidence=ECO:0000269|PubMed:28514449 352..355
TM helix 7 381..406 CDD:341342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.