DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and GLP1R

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_002053.3 Gene:GLP1R / 2740 HGNCID:4324 Length:463 Species:Homo sapiens


Alignment Length:440 Identity:113/440 - (25%)
Similarity:183/440 - (41%) Gaps:92/440 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 PQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDT--RKFAIRKCELDGRWGSRPNATEVN 272
            |.|.|:||.|:|...|||....|....::||.......:  :....|.|..:|.|..:.|::   
Human    56 PATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSS--- 117

  Fly   273 PPGWTDYGPCYK--------PEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLL 329
             ..|.|...|.:        ||     :|:    ...||        :..||..||..||:::..
Human   118 -LPWRDLSECEESKRGERSSPE-----EQL----LFLYI--------IYTVGYALSFSALVIASA 164

  Fly   330 IFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAAT------------------ 376
            |...||.|...|..||.|||.:.:|:.   |::::       |:||.                  
Human   165 ILLGFRHLHCTRNYIHLNLFASFILRA---LSVFI-------KDAALKWMYSTAAQQHQWDGLLS 219

  Fly   377 -NTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCV 440
             ..|||        |...::|::|...|.:.|:.:||:||:.::..:|....:..:.:..:||.|
Human   220 YQDSLS--------CRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGV 276

  Fly   441 PILMTTVWARCTVMYMDTSLGECLWNYNLTPYYW-ILEGPRLAVILLNFCFLVNIIRVLVMKLRQ 504
            |:|....|.....:|.|    |..|..|....|| |:..|.|..|.:||...|.:|.::|.||:.
Human   277 PLLFVVPWGIVKYLYED----EGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKA 337

  Fly   505 SQASDIEQTRKAVRAAIVLLPLLGITNLL-------HQLAPLKTATNFAVWSYGTHFLTSFQGFF 562
            :.....:...:..::.:.|:||||...::       |....|:....|...|:     |||||..
Human   338 NLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSF-----TSFQGLM 397

  Fly   563 IALIYCFLNGEVRAVLLKS----LATQLSVRGHPEWAPKR---ASMYSGA 605
            :|::|||:|.||:....||    ....|.::......|.:   :|:.|||
Human   398 VAILYCFVNNEVQLEFRKSWERWRLEHLHIQRDSSMKPLKCPTSSLSSGA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 16/60 (27%)
7tm_4 306..563 CDD:304433 72/283 (25%)
GLP1RNP_002053.3 HRM 60..128 CDD:280888 19/71 (27%)
7tm_2 144..398 CDD:278432 74/288 (26%)
Important for allosteric inhibitor binding. /evidence=ECO:0000269|PubMed:28514449 352..355 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.