DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and Gipr

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_036846.1 Gene:Gipr / 25024 RGDID:2689 Length:455 Species:Rattus norvegicus


Alignment Length:442 Identity:133/442 - (30%)
Similarity:206/442 - (46%) Gaps:80/442 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 TLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPG--GFHGVDTRKFAIRKCELDGRWGSRPNATE 270
            |.|.:||.||.::|...||..|.|...||::||.  .::......|..|:|..||:|||      
  Rat    50 TEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGS------ 108

  Fly   271 VNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYID---IARRTRTLEIVGLCLSLFALIVSLLIFC 332
                 |.|:..|..||          |: .|:.|   |..|.:.:..||..|||..|:::|||..
  Rat   109 -----WRDHTQCENPE----------KN-GAFQDQKLILERLQVVYTVGYSLSLATLLLALLILS 157

  Fly   333 TFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQF------RRGNKEAATNTSLSVIENTPYL-- 389
            .||.|...|..||.|||.:.:|:....||  .||.      ..||:             ||.|  
  Rat   158 LFRRLHCTRNYIHMNLFTSFMLRAGAILT--RDQLLPPLGPYTGNQ-------------TPTLWN 207

  Fly   390 -----CEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWA 449
                 |..:.:|.:|...|.:.|:.:||:|||:::.|.........:.:..|||..|.|....|.
  Rat   208 QALAACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCYLLLGWGAPALFVIPWV 272

  Fly   450 RCTVMYMDTSLGECLWNYN-LTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQT 513
            ....:|.:|   :| |..| :...:||:..|.|..||:||...:.|:.:||.|||..|....:..
  Rat   273 IVRYLYENT---QC-WERNEVKAIWWIIRTPILITILINFLIFIRILGILVSKLRTRQMRCPDYR 333

  Fly   514 RKAVRAAIVLLPLLGITNLLHQLAPL-----KTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGE 573
            .:..|:.:.|:||||:..::  .||:     :.:..||..::.. ||:|||||.::::|||:|.|
  Rat   334 LRLARSTLTLMPLLGVHEVV--FAPVTEEQAEGSLRFAKLAFEI-FLSSFQGFLVSVLYCFINKE 395

  Fly   574 VRAVLLK---SLATQLSVRGHPEWAPKRASMYSGAYNTAPDTDAVQ---PAG 619
            |::.:.:   ||..|.. |.|...||:...:     ::||...|::   |:|
  Rat   396 VQSEIRRLRLSLQEQCP-RPHLGQAPRAVPL-----SSAPQEAAIRNALPSG 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 21/60 (35%)
7tm_4 306..563 CDD:304433 83/275 (30%)
GiprNP_036846.1 HRM 55..118 CDD:280888 24/73 (33%)
7tm_2 131..385 CDD:278432 83/275 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.