DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and mthl13

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_788325.2 Gene:mthl13 / 246395 FlyBaseID:FBgn0050018 Length:440 Species:Drosophila melanogaster


Alignment Length:265 Identity:47/265 - (17%)
Similarity:99/265 - (37%) Gaps:70/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 DYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLE----IVGLCLSLF----ALIVSLLIFCTF 334
            |:|.|....:..|.       .|..|.:....|.|:    :.|..:..|    ::..|::.:|.:
  Fly   195 DFGKCVMSCVFCLF-------LDYLIWLMDELRLLDDFCSLTGYIMFFFDFANSVWFSIISYCIW 252

  Fly   335 RSLRNNRTKIHKNLFV----------AMVLQVIIRLTLYLDQ-FRRGNKEAATNTSLSVIENTPY 388
            :.:.:..::.:::.||          |:.|.:||.:..:.:: .|:.|.......|...:::   
  Fly   253 KKITSVVSQENRDQFVFYSTFAYGISAIPLGIIISINQFWEEDLRKWNWLPLVGFSRCSVDD--- 314

  Fly   389 LCEAS---YVLLEYA-RTAMFMWMFIEGL--------YLHNM----------VTVAVFQGSFPLK 431
             |:.|   |..:.|| ..|:.:.||:..:        .|||:          |||........|.
  Fly   315 -CKRSSWVYYFVPYAIMCAINIIMFVLTIKHIMKTKRNLHNLTKRPDRNETCVTVNFLNFELYLL 378

  Fly   432 FFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIR 496
            |....|     :|...|.....:.::.         |.|  :|.:.|  :.:..:::.|.:.:..
  Fly   379 FLRISG-----IMGVAWILIIFLLIEV---------NST--FWDIFG--IIIQQIHYGFGIILFV 425

  Fly   497 VLVMK 501
            :|:.|
  Fly   426 LLIFK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888
7tm_4 306..563 CDD:304433 41/237 (17%)
mthl13NP_788325.2 Mth_Ecto <49..158 CDD:299804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.