DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and Fbxo46

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_780739.1 Gene:Fbxo46 / 243867 MGIID:2444918 Length:603 Species:Mus musculus


Alignment Length:250 Identity:55/250 - (22%)
Similarity:76/250 - (30%) Gaps:90/250 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SNILDCGGCISAQRF---TRLLRQSGSSGPSPSAPTAGTFESKSMLEPTSSHSLATGRVPLLHDF 135
            |.:.:......|||.   |:.||:....||.|..... .|...::.||              |..
Mouse   225 SRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRI-AFRISNVREP--------------HSP 274

  Fly   136 DAST--------------TESPGTYVLDGVARVAQLALEPTVMDALPDSDTEQVLGNLNSSAPWN 186
            |.:.              :..|||...|.:.......:.|: .|||| |:.|.:|...:.     
Mouse   275 DGNLPNGGGGRPGCAYPGSPGPGTRAKDKITCDLYQLISPS-RDALP-SNVEFLLARADE----- 332

  Fly   187 LTLASAAATNFENCSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFH------G 245
               ||...|...         |.|:         ||    ||.|....||.....|||      |
Mouse   333 ---ASEGETPAP---------TRPE---------DT----PPAPPPPPARDCGASGFHVDVVVTG 372

  Fly   246 VDTRKFAIRKCELDGRWGSR----------PNATEVNPPGWTDY----GPCYKPE 286
            |      :..|...|:.|::          .:..|..|||...:    ||...||
Mouse   373 V------VDACIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQSRGPEGPPE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 16/74 (22%)
7tm_4 306..563 CDD:304433
Fbxo46NP_780739.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..165
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..301 17/80 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..359 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..442 3/9 (33%)
F-box-like 473..>507 CDD:372399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.