DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and Vipr2

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_033537.1 Gene:Vipr2 / 22355 MGIID:107166 Length:437 Species:Mus musculus


Alignment Length:418 Identity:112/418 - (26%)
Similarity:185/418 - (44%) Gaps:62/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 CSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRK-CELDGRWG 263
            |:.|..:.|..|..  |:..||.:.||.|...|....:.||..|....:|...|.| |..|| | 
Mouse    37 CAELLSSQTENQRA--CSGVWDNITCWRPADVGETVTVPCPKVFSNFYSRPGNISKNCTSDG-W- 97

  Fly   264 SRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSL 328
            |......::..|:.|      ||        .......||.:    :.:..:|..:||.:|....
Mouse    98 SETFPDFIDACGYND------PE--------DESKISFYILV----KAIYTLGYSVSLMSLTTGS 144

  Fly   329 LIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVI--ENTPYL-- 389
            :|.|.||.|...|..||.|||::.:|:.|..|.          |::...:|..::  .:.|..  
Mouse   145 IIICLFRKLHCTRNYIHLNLFLSFMLRAISVLV----------KDSVLYSSSGLLRCHDQPASWV 199

  Fly   390 -CEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTV 453
             |:.|.|..:|...|.|.|:.:||||||.:: ||:...|.....:..:||.:|.:....|....:
Mouse   200 GCKLSLVFFQYCIMANFYWLLVEGLYLHTLL-VAILPPSRCFLAYLLIGWGIPSVCIGAWTATRL 263

  Fly   454 MYMDTSLGECLWNYN--LTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQ--ASDIEQTR 514
            ...||.   | |:.|  ..| :|::..|.|..|::||...::|:|:|:.||....  .:|..|.:
Mouse   264 SLEDTG---C-WDTNDHSIP-WWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQYK 323

  Fly   515 KAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHF---LTSFQGFFIALIYCFLNGEVRA 576
            :..::.::|:||.|:..::....|:..::.:.:.     |   :.||||..:|::|||||.||:.
Mouse   324 RLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQIL-----FELCVGSFQGLVVAVLYCFLNSEVQC 383

  Fly   577 VLLKS----LATQLSVRGH--PEWAPKR 598
            .|.:.    ..||...|.:  ..|:..|
Mouse   384 ELKRRWRGLCLTQAGSRDYRLHSWSMSR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 18/59 (31%)
7tm_4 306..563 CDD:304433 70/268 (26%)
Vipr2NP_033537.1 HormR 47..117 CDD:214468 23/87 (26%)
7tm_2 122..370 CDD:278432 72/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.