DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and Inmt

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_033375.1 Gene:Inmt / 21743 MGIID:102963 Length:264 Species:Mus musculus


Alignment Length:84 Identity:21/84 - (25%)
Similarity:26/84 - (30%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PGGFHGVDTRKFAIRKCELDG---RWGS-----RPNATEV-------NPPGWTDYGPCYKPEIIR 289
            ||.:   |........|||:|   ||..     |...|.|       .||..:...|.....:..
Mouse   103 PGAY---DWSSIVQHACELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTF 164

  Fly   290 LMQQMGSKDFDAYIDIARR 308
            |..:....|.|.|....||
Mouse   165 LAMECACPDIDTYRAALRR 183

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 12/46 (26%)
7tm_4 306..563 CDD:304433 2/3 (67%)
InmtNP_033375.1 NNMT_PNMT_TEMT 1..260 CDD:250464 21/84 (25%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 64..65