DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and Nnmt

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_035054.1 Gene:Nnmt / 18113 MGIID:1099443 Length:264 Species:Mus musculus


Alignment Length:53 Identity:13/53 - (24%)
Similarity:24/53 - (45%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 CYKPEIIRLMQQ-------MGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVS 327
            |.:.||:|.:.:       :|:...:..|||.......:::..|.|...:|||
Mouse    32 CAENEILRHLLKNLFKIFCLGAVKGELLIDIGSGPTIYQLLSACESFTEIIVS 84

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888
7tm_4 306..563 CDD:304433 5/22 (23%)
NnmtNP_035054.1 NNMT_PNMT_TEMT 2..259 CDD:395988 13/53 (25%)