DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and CRHR2

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001189404.1 Gene:CRHR2 / 1395 HGNCID:2358 Length:438 Species:Homo sapiens


Alignment Length:408 Identity:131/408 - (32%)
Similarity:196/408 - (48%) Gaps:61/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 YCNWTWDTL-LCWPPTPAGVLARMNCPGGFHGV--DTRKFAIRKCELDGRWGSRPNATEVNPPGW 276
            |||.|.|.: .|||.:.||.|....||..|:||  :|.:.|.|:|..:|.|.|:.|.::..|   
Human    66 YCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEP--- 127

  Fly   277 TDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNR 341
                      |:...|    :.:|.:..||   ..:..:|.|:|:.||:.:.|:|...||:|..|
Human   128 ----------ILDDKQ----RKYDLHYRIA---LVVNYLGHCVSVAALVAAFLLFLALRSIRCLR 175

  Fly   342 TKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFM 406
            ..||.||....:|:.::...|.|             ....|.|:....|.....:..|.....|.
Human   176 NVIHWNLITTFILRNVMWFLLQL-------------VDHEVHESNEVWCRCITTIFNYFVVTNFF 227

  Fly   407 WMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNY---N 468
            |||:||.|||..:.:...........|..:|||:|..:...||...:.|.:.   :|.:..   :
Human   228 WMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENE---QCWFGKEPGD 289

  Fly   469 LTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLL 533
            |..|  |.:||.:.|:|:||.||.||:|:|:.|||.|..|:..|.||||:|.:|||||||||.:|
Human   290 LVDY--IYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYML 352

  Fly   534 HQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLK-------------SLATQ 585
            ..:.|.:...:..::.|...||.||||||:::.|||.|||||:.:.|             .:|..
Human   353 FFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARA 417

  Fly   586 LSVRGHPEWAPKRASMYS 603
            :|:    ..:|.|.|.:|
Human   418 MSI----PTSPTRISFHS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 24/59 (41%)
7tm_4 306..563 CDD:304433 86/259 (33%)
CRHR2NP_001189404.1 HormR 63..134 CDD:214468 27/84 (32%)
7tm_2 140..382 CDD:278432 87/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2715
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.