DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and INMT

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_006765.4 Gene:INMT / 11185 HGNCID:6069 Length:263 Species:Homo sapiens


Alignment Length:129 Identity:31/129 - (24%)
Similarity:49/129 - (37%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQ---QMGSKDFDA 301
            ||.:......|||   |||:|..|.           |.:.....:..:.|:::   .:|:....|
Human   102 PGAYDWTPAVKFA---CELEGNSGR-----------WEEKEEKLRAAVKRVLKCDVHLGNPLAPA 152

  Fly   302 YIDIARRTRT-LEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYL 364
            .:.:|....| |.:...|.||.|...:|   |...||.  :...|      :|..|.:||..|:
Human   153 VLPLADCVLTLLAMECACCSLDAYRAAL---CNLASLL--KPGGH------LVTTVTLRLPSYM 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 10/31 (32%)
7tm_4 306..563 CDD:304433 17/60 (28%)
INMTNP_006765.4 NNMT_PNMT_TEMT 4..259 CDD:250464 31/129 (24%)
S-adenosyl-L-methionine binding 85..87