DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and gipr

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_005157796.1 Gene:gipr / 101885360 ZFINID:ZDB-GENE-050516-4 Length:514 Species:Danio rerio


Alignment Length:446 Identity:126/446 - (28%)
Similarity:200/446 - (44%) Gaps:82/446 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 TGLYCNWTWDTLLCWPPTPAGVLARMNCPG--GFHGVDTRKFAIRKCELDGRWGSRPNATEVNPP 274
            :||:|...:|...||.........::.||.  .:|......|..|:|..||:|     .|..:..
Zfish    51 SGLFCKSMFDMYACWTDGVPNTTVKVPCPWYLPWHDQVRNGFVSRECGPDGQW-----LTVNHSS 110

  Fly   275 GWTDYGPCY---KPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRS 336
            .|.|:..|.   :.:|.:..|.|          :....|.:..||..|||.:|.::|:|...||.
Zfish   111 TWRDHSQCNADGRQQIAQENQMM----------VLAYFRVMYTVGYSLSLASLSLALIILLIFRK 165

  Fly   337 LRNNRTKIHKNLFVAMVLQVIIRLT----LYLD--QFRRGNKEAATNTSLSVIENTPYLCEASYV 395
            ||..|..||.|||.:.:|:.:..||    |..|  :| |.||:.:...|..|:..    |..:.|
Zfish   166 LRCTRNYIHTNLFASFILRAVSILTRDALLMKDAPEF-RDNKDVSIVLSDQVMSG----CRVAQV 225

  Fly   396 LLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSL 460
            |::|...|.:.|:.:|||||||::.:.||..:..:..:..:||..|:|....|.....:|.:|..
Zfish   226 LMQYCVGANYYWLLVEGLYLHNLLVLMVFSENSYICVYFFIGWGTPVLFVVPWIIVRYLYENTRC 290

  Fly   461 GECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLP 525
            .|.  |.|:. |:||:..|.|..||:||...:.||.:|:.||:..|....:...:..::.:.|:|
Zfish   291 WEI--NENMA-YWWIIRTPILLAILVNFFIFIRIILILISKLKAHQMRYTDYKFRLAKSTLTLIP 352

  Fly   526 LLGITNLLHQLAPLKTATNFAVWS-------------YGTHFLTSFQGFFIALIYCFLNGEVRAV 577
            ||||    |::.       |||.:             :...|..|||||.:|::|||:|.||::.
Zfish   353 LLGI----HEVV-------FAVMTEEQTEGVLRNVNLFFELFFNSFQGFLVAILYCFVNKEVQSE 406

  Fly   578 LLKSLATQLSVRGHPEWAPKR--ASMYSGAYNTAPDTDAVQPAG-------DPSAT 624
            :.|            :|...:  .|:.....||..:|   ||.|       ||:.:
Zfish   407 IKK------------KWQRWKLGISILDDQRNTGSNT---QPVGTGPQCHHDPACS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 16/60 (27%)
7tm_4 306..563 CDD:304433 86/275 (31%)
giprXP_005157796.1 HRM 52..121 CDD:280888 19/73 (26%)
7tm_2 139..392 CDD:278432 86/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.