DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment z and RB1

DIOPT Version :9

Sequence 1:NP_001259190.1 Gene:z / 31230 FlyBaseID:FBgn0004050 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_000312.2 Gene:RB1 / 5925 HGNCID:9884 Length:928 Species:Homo sapiens


Alignment Length:177 Identity:36/177 - (20%)
Similarity:64/177 - (36%) Gaps:60/177 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 PTVTAATTVPAAVPVP-VATASSGSANSVAVNTSTASSVSINNTSLGGGGGNGATNASATAADSF 504
            ||....:..|..:|:. ..||:....:.|.......|:..:|:|:          ||...|..:|
Human   582 PTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTA----------NAETQATSAF 636

  Fly   505 EER---------MNYFKI-REAELRCKE--QQLATEAKRIE-------LNKAQDELKYMKEVH-- 548
            :.:         :.|.|: |.|.||...  ::|.:|...:|       .:..|:|.:.|::.|  
Human   637 QTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLD 701

  Fly   549 -----------RLRVEELTMKI-----------------RILQKEEE 567
                       :::..:|..||                 |:|.||||
Human   702 QIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEE 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zNP_001259190.1 GT1 53..125 CDD:304916
RB1NP_000312.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
DUF3452 114..225 CDD:371807
Pocket, binds T and E1A 373..771 36/177 (20%)
Domain A 373..579
RB_A 373..573 CDD:366846
Spacer 580..639 14/66 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..632 6/31 (19%)
Domain B 640..771 22/109 (20%)
RB_B 646..765 CDD:366845 22/103 (21%)
Interaction with LIMD1. /evidence=ECO:0000269|PubMed:15542589 763..928
Rb_C 768..924 CDD:370194
Domain C, mediates interaction with E4F1. /evidence=ECO:0000269|PubMed:10869426 771..928
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 860..928
Bipartite nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P13405 860..876
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3143
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.