| Sequence 1: | NP_001259190.1 | Gene: | z / 31230 | FlyBaseID: | FBgn0004050 | Length: | 605 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_033055.2 | Gene: | Rb1 / 19645 | MGIID: | 97874 | Length: | 921 | Species: | Mus musculus |
| Alignment Length: | 206 | Identity: | 37/206 - (17%) |
|---|---|---|---|
| Similarity: | 71/206 - (34%) | Gaps: | 50/206 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 76 DIKHRKKQRNKYSV--RETWDKIVKDFNS-----------------HPHVSAMRNIKQIQKFWLN 121
Fly 122 SRLR----------KQYPYRDGSSSNLSSGSAKISSVSVSVASAVPQQQQQQHHQQHDSVKVEPE 176
Fly 177 YQISPDASEHNPQADTFDEIEMDANDVSEIDED---PMEQQQQQQQEAQAQAQAQAQAQAQVQSA 238
Fly 239 AAEMQKMQQVN 249 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| z | NP_001259190.1 | GT1 | 53..125 | CDD:304916 | 12/67 (18%) |
| Rb1 | NP_033055.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..36 | ||
| DUF3452 | 112..219 | CDD:371807 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 341..360 | ||||
| Pocket, binds T and E1A. /evidence=ECO:0000250 | 367..764 | 8/40 (20%) | |||
| Domain A. /evidence=ECO:0000250 | 367..573 | ||||
| RB_A | 367..567 | CDD:366846 | |||
| Spacer. /evidence=ECO:0000250 | 574..632 | ||||
| Domain B. /evidence=ECO:0000250 | 633..764 | 8/40 (20%) | |||
| RB_B | 639..758 | CDD:366845 | 8/34 (24%) | ||
| Interaction with LIMD1. /evidence=ECO:0000250 | 756..921 | 29/173 (17%) | |||
| Rb_C | 761..917 | CDD:370194 | 29/168 (17%) | ||
| Domain, mediates interaction with E4F1. /evidence=ECO:0000250 | 764..921 | 29/165 (18%) | |||
| Bipartite nuclear localization signal. /evidence=ECO:0000269|PubMed:8336704 | 853..869 | 3/16 (19%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 872..921 | 13/53 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3143 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||