DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boi and cntn1

DIOPT Version :10

Sequence 1:NP_001096868.3 Gene:boi / 31229 FlyBaseID:FBgn0040388 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_002932857.1 Gene:cntn1 / 100487602 XenbaseID:XB-GENE-491714 Length:1005 Species:Xenopus tropicalis


Alignment Length:901 Identity:186/901 - (20%)
Similarity:284/901 - (31%) Gaps:334/901 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TLQASDSNSSVATTLGVL--FERAPESAVAPKGDEVVFECEL-NLKPDRLEWRFRRG-DSSEPYL 80
            |.:|..:::.::.:..||  |...||       ||..:|||. |:|          | |:.:.|:
 Frog   264 TNEAMPASAEISMSGAVLKIFNIQPE-------DEGTYECEAKNIK----------GMDTHKAYV 311

  Fly    81 YLRPSAGY----NVTS---GSDGLAWRLRIYVSAQTAGDYQCVAWYGPGALASTPARLALVSIAL 138
            |:.....:    |.|.   ||| |.|              .|||...|                 
 Frog   312 YVEGVPEWVEHINDTERDIGSD-LHW--------------ACVAKGKP----------------- 344

  Fly   139 DVGQGSMGARSSIRWSVAPKNCLLIRCGSVISNPPAIWSFYRNGKKLPQSELLPGAAGALVLDTV 203
                     :.||||                         .:||...        ..|.|:...:
 Frog   345 ---------QPSIRW-------------------------LKNGASY--------GKGDLIKRGL 367

  Fly   204 TAKDAGNYSCVATNSITGDELRLPQTIELRVDYTDRTPPYFLQRPPIEYS-------ARPGETVV 261
            |.:|||.|.|:|.| :.|            :.|.:.........|..|::       |..|..|:
 Frog   368 TLEDAGMYQCIAEN-MHG------------IIYANAELKILALAPTFEFTPMRKKVLAAKGGRVI 419

  Fly   262 LECPGVGSPRPRVIWSSPNVVEIYNNRSTILSYG-LQITDVKPEDQGSYICMLDN--GIAPPIDH 323
            :||....:|:.:..||....:.|.::|.:|...| |:|.::...|:|||.|..:|  |.|   :.
 Frog   420 IECKPKAAPKAKFSWSKGTELLINSSRVSIWDDGSLEILNITKLDEGSYTCFAENDRGKA---NS 481

  Fly   324 TIKLSVLQRPTILRGPAATLTNESNPLLLDCSASGNPQPDI--YWLINGEDATKDPEAVVDNRSL 386
            |..|||.....|...|:...........:.|.||.:|..|:  .|.:||.....|.|.....|::
 Frog   482 TGVLSVTAATKITLAPSNADVTVGENATMQCHASHDPTLDLTFIWTLNGFPIEFDKEDGHYERAI 546

  Fly   387 Q--------LKRVQKRHAGVVQCFAKNILGETSEGNILRVNPLEITGEDDEPLGEVPVWPVHESN 443
            :        :|..|.:|||...|.|:.|:..:|....|.|.         .|.|           
 Frog   547 RNDVGSELVIKNAQLKHAGRYTCTAQTIVDNSSASADLVVR---------GPPG----------- 591

  Fly   444 TGMGTSSTSGGSKNKSGRRKFKASMVPPSRPNVTRLSDESVMLRWSVPQNSGLQITFFKVQYRML 508
                                      ||....|..:.|.||.|.||...::...|:.:.:|.:.:
 Frog   592 --------------------------PPGGVRVEEIRDTSVKLTWSSGTDNHQPISKYNIQAKNI 630

  Fly   509 -----GDGKNRRKN---------------W-----QTTSDNI----------PYGNAHGSGP--- 535
                 .|.|....|               |     :.|:.|.          |.....|:.|   
 Frog   631 LSEDWKDVKTENPNIEGNMEMARAIDLIPWMDYEFRVTATNTLGVGEPSLPSPKIRTEGAAPIVA 695

  Fly   536 -----GQGNSH------WRARNRDREYEMGNPPKNFTSSVTGLTAGKYYRFRIVAV-------YS 582
                 |.|.|:      |:..:|:..|..|      ...|.......|..:|.|.|       |.
 Frog   696 PAEVGGGGGSNRELTVTWQPLSREYHYGDG------FGYVVAFKLFNYREWRKVIVTNPESGHYV 754

  Fly   583 NNDN-----KEGNTSLKFFLQNGT----------SKSNLPV--PELREVETLSESAVVLHWSLVS 630
            :.|:     .:....:|.|.:.|.          |..::|:  |.......||.|.|.:.|..| 
 Frog   755 HKDDTITPATQFQVKVKAFNKVGEGPYSSTVVIYSAEDVPIEAPTAIVYNILSSSEVSVAWHPV- 818

  Fly   631 STQNEDIDGYYA-YYRPADSAAEYLKATVDGGMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSA 694
              ..:.|:||.. |:|..|..|...:..|... ..:.:::.|.|.|.|..::::|||......|.
 Frog   819 --YEKSIEGYQVRYWRTQDKEAAAHRVQVKAS-DITTRLEGLLPDTHYNLEVRAFNSAGDGPPSR 880

  Fly   695 IRQARTRKT-----------------------HEQPASSSAT----------------------- 713
            :....|:|.                       |..|.|:.:.                       
 Frog   881 VITFLTKKAPPSQKPRITSAVRYGSQYIITWEHVVPLSNESAVNGYKVLYRQDGQRDGKLYSTGK 945

  Fly   714 -----PVP--ANKAVEQHQNS-------LYPLIAGAAGG------GILLLIASLVV 749
                 |||  ....||...:|       .|..|:|.|.|      ||||.|.||::
 Frog   946 HSVELPVPEEGEYVVEVRAHSEGGDGAVAYIKISGDATGILPSFLGILLPILSLLM 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
boiNP_001096868.3 IG_like 42..131 CDD:214653 24/97 (25%)
Ig 161..221 CDD:409353 12/59 (20%)
Ig strand B 161..165 CDD:409353 0/3 (0%)
Ig strand C 175..179 CDD:409353 0/3 (0%)
Ig strand E 196..200 CDD:409353 2/3 (67%)
Ig strand F 210..215 CDD:409353 2/4 (50%)
Ig 242..315 CDD:472250 21/80 (26%)
Ig strand B 260..264 CDD:409353 1/3 (33%)
Ig strand C 273..277 CDD:409353 0/3 (0%)
Ig strand E 294..298 CDD:409353 2/4 (50%)
Ig strand F 308..313 CDD:409353 3/4 (75%)
Ig <352..408 CDD:472250 19/65 (29%)
Ig strand C 363..367 CDD:409353 1/5 (20%)
Ig strand E 384..388 CDD:409353 1/11 (9%)
Ig strand F 398..403 CDD:409353 1/4 (25%)
FN3 <448..>700 CDD:442628 62/325 (19%)
FN3 613..700 CDD:238020 22/87 (25%)
cntn1XP_002932857.1 Ig 24..118 CDD:472250
Ig strand B 45..49 CDD:409353
Ig strand C 58..62 CDD:409353
Ig strand E 80..84 CDD:409353
Ig strand F 95..100 CDD:409353
Ig strand G 109..112 CDD:409353
Ig2_Contactin-2-like 126..214 CDD:409392
Ig strand A 128..133 CDD:409392
Ig strand B 137..143 CDD:409392
Ig strand C 152..158 CDD:409392
Ig strand C' 163..165 CDD:409392
Ig strand D 170..175 CDD:409392
Ig strand E 178..182 CDD:409392
Ig strand F 192..200 CDD:409392
Ig strand G 202..214 CDD:409392
Ig 227..314 CDD:472250 18/66 (27%)
Ig strand B 245..249 CDD:409353
Ig strand C 258..262 CDD:409353
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig 318..394 CDD:472250 29/162 (18%)
Ig strand B 334..338 CDD:409353 2/17 (12%)
Ig strand C 347..351 CDD:409353 4/28 (14%)
Ig strand E 360..364 CDD:409353 2/3 (67%)
Ig strand F 374..379 CDD:409353 2/4 (50%)
Ig strand G 387..390 CDD:409353 1/2 (50%)
Ig 399..487 CDD:472250 26/90 (29%)
Ig strand B 418..422 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 453..457 CDD:409353 2/3 (67%)
Ig strand F 467..472 CDD:409353 3/4 (75%)
Ig strand G 480..483 CDD:409353 0/2 (0%)
Ig6_Contactin 490..584 CDD:409359 22/93 (24%)
Ig strand A 490..495 CDD:409359 1/4 (25%)
Ig strand A' 498..503 CDD:409359 0/4 (0%)
Ig strand B 506..514 CDD:409359 1/7 (14%)
Ig strand C 523..527 CDD:409359 0/3 (0%)
Ig strand D 548..551 CDD:409359 0/2 (0%)
Ig strand E 552..556 CDD:409359 0/3 (0%)
Ig strand F 565..572 CDD:409359 2/6 (33%)
Ig strand G 579..583 CDD:409359 1/3 (33%)
FN3 596..687 CDD:238020 16/90 (18%)
FN3 <663..>931 CDD:442628 52/277 (19%)
FN3 909..972 CDD:238020 9/62 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.