DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and MRPS12

DIOPT Version :9

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_014434.1 Gene:MRPS12 / 855772 SGDID:S000005319 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:64/136 - (47%)
Similarity:82/136 - (60%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ISNSF-TSLPAIQCSYETAVRGMASLQQMHR-SGP----HIKTRPPRQPLDGKPFAKGVVLKTLI 81
            :||:: |.|...|..:.:.....|:|.|:.| |||    .|.|.|   .||..|..|||||:.::
Yeast     6 MSNTWCTPLRQAQRLFSSTTTMQATLNQIKRGSGPPRRKKISTAP---QLDQCPQRKGVVLRVMV 67

  Fly    82 KKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHNIVLCRVGRLQDVPGVKLKAVRGVYDL 146
            .||||||||.||...|||:.|..:.|||||.||:.|||:||..|.||.||:||||...:||..||
Yeast    68 LKPKKPNSAQRKACRVRLTNGNVVSAYIPGEGHDAQEHSIVYVRGGRCQDLPGVKYHVIRGAGDL 132

  Fly   147 AHVVKK 152
            :.||.:
Yeast   133 SGVVNR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 58/110 (53%)
MRPS12NP_014434.1 rpsL_bact 28..152 CDD:130054 59/114 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I1694
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6848
Inparanoid 1 1.050 102 1.000 Inparanoid score I1447
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003097
OrthoInspector 1 1.000 - - oto99146
orthoMCL 1 0.900 - - OOG6_101451
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1260
SonicParanoid 1 1.000 - - X2071
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.