DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and AT5G02960

DIOPT Version :10

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_195916.1 Gene:AT5G02960 / 831724 AraportID:AT5G02960 Length:142 Species:Arabidopsis thaliana


Alignment Length:102 Identity:36/102 - (35%)
Similarity:62/102 - (60%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG--HNLQEHN-IVL 123
            ::|..|...|||:||:.:..:.|:||||.|||..|:| ..||::.|::|..|  :.::|:: :::
plant    37 KKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLI 101

  Fly   124 CRVGR----LQDVPGVKLKAVR--GVYDLAHVVKKSQ 154
            ...||    :.|:|||:.|.|:  ||..||...:|.:
plant   102 AGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 35/98 (36%)
AT5G02960NP_195916.1 PTZ00067 1..142 CDD:185422 36/102 (35%)

Return to query results.
Submit another query.