DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and RPS23

DIOPT Version :9

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001016.1 Gene:RPS23 / 6228 HGNCID:10410 Length:143 Species:Homo sapiens


Alignment Length:120 Identity:40/120 - (33%)
Similarity:63/120 - (52%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RGMASLQQM--HR----------SGPHIKTRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKC 94
            ||:.:.:::  ||          ...|:.|.....|..|...|||:||:.:..:.|:||||.|||
Human     5 RGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKC 69

  Fly    95 VLVRL-STGKEMVAYIPGIG-HNLQEHN--IVLCRVGR----LQDVPGVKLKAVR 141
            |.|:| ..||::.|::|..| .|..|.|  :::...||    :.|:|||:.|.|:
Human    70 VRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 38/116 (33%)
RPS23NP_001016.1 PTZ00067 1..143 CDD:185422 40/120 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.