DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and MRPS12

DIOPT Version :9

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_066930.1 Gene:MRPS12 / 6183 HGNCID:10380 Length:138 Species:Homo sapiens


Alignment Length:141 Identity:79/141 - (56%)
Similarity:90/141 - (63%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSDISNSFTSLPAI------QCSYETAVRGMASLQQMHRSGPHIKTRPPRQ--PLDGKPFAKGVV 76
            |..::.|.|..||:      .||       ||:|.||||.||  ..||||:  |.:|:|..||||
Human     7 LHGLNTSLTCGPALVPRLWATCS-------MATLNQMHRLGP--PKRPPRKLGPTEGRPQLKGVV 62

  Fly    77 LKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHNIVLCRVGRLQDVPGVKLKAVR 141
            |.|..:||||||||||||..||||||:|.|.:|||.||.||||.|||...||.||:|||||..||
Human    63 LCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVR 127

  Fly   142 GVYDLAHVVKK 152
            |.||..||.||
Human   128 GKYDCGHVQKK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 68/107 (64%)
MRPS12NP_066930.1 Ribosomal_S12 32..138 CDD:239466 68/107 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6179
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6848
Inparanoid 1 1.050 138 1.000 Inparanoid score I4541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49546
OrthoDB 1 1.010 - - D1542634at2759
OrthoFinder 1 1.000 - - FOG0003097
OrthoInspector 1 1.000 - - oto88787
orthoMCL 1 0.900 - - OOG6_101451
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1260
SonicParanoid 1 1.000 - - X2071
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.