DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and Rps23-ps11

DIOPT Version :10

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_038938807.1 Gene:Rps23-ps11 / 501058 RGDID:1563705 Length:143 Species:Rattus norvegicus


Alignment Length:120 Identity:40/120 - (33%)
Similarity:63/120 - (52%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RGMASLQQM--HR----------SGPHIKTRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKC 94
            ||:.:.:::  ||          ...|:.|........|...|||:||:.:..:.|:||||.|||
  Rat     5 RGLCTARKLRSHRRDQKWHDKQYKKAHLGTALKANLFGGASHAKGIVLEKVGVEAKQPNSAIRKC 69

  Fly    95 VLVRLST-GKEMVAYIPGIG-HNLQEHN--IVLCRVGR----LQDVPGVKLKAVR 141
            |.|:||. ||::.|::|..| .|..|.|  :::...||    :.|:|||:.|.|:
  Rat    70 VRVQLSKYGKKITAFVPNDGCLNFIEENDKVLVVGFGRKGHAVGDIPGVRFKVVK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 38/116 (33%)
Rps23-ps11XP_038938807.1 PTZ00067 1..143 CDD:185422 40/120 (33%)

Return to query results.
Submit another query.