DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and Mrps12

DIOPT Version :9

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001099709.1 Gene:Mrps12 / 292758 RGDID:1306221 Length:139 Species:Rattus norvegicus


Alignment Length:115 Identity:73/115 - (63%)
Similarity:84/115 - (73%) Gaps:4/115 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AVRGMASLQQMHRSGPHIKTRPPRQ--PLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRLSTG 102
            |.|.||:|.||||.|.  ...||::  |.:|:|..|||||:|.|:||||||||||||..||||||
  Rat    26 ATRSMATLNQMHRLGR--PKEPPKRLGPTEGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTG 88

  Fly   103 KEMVAYIPGIGHNLQEHNIVLCRVGRLQDVPGVKLKAVRGVYDLAHVVKK 152
            ||.|.:|||.||.||||::||...||.||:||||||.|||.||..||.||
  Rat    89 KEAVCFIPGEGHTLQEHHVVLVEGGRTQDLPGVKLKVVRGKYDCGHVQKK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 67/107 (63%)
Mrps12NP_001099709.1 Ribosomal_S12 32..138 CDD:239466 67/107 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346228
Domainoid 1 1.000 121 1.000 Domainoid score I5576
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6848
Inparanoid 1 1.050 143 1.000 Inparanoid score I4375
OMA 1 1.010 - - QHG49546
OrthoDB 1 1.010 - - D1542634at2759
OrthoFinder 1 1.000 - - FOG0003097
OrthoInspector 1 1.000 - - oto95920
orthoMCL 1 0.900 - - OOG6_101451
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2071
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.