DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and SPAC4F8.06

DIOPT Version :9

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_593866.2 Gene:SPAC4F8.06 / 2543614 PomBaseID:SPAC4F8.06 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:92 Identity:54/92 - (58%)
Similarity:62/92 - (67%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KTRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHNIV 122
            ||......|:|.||.:||..:....||||||||.||...||||||:.:.|||||||||.|||.:|
pombe    53 KTNKQSVALEGSPFRRGVCTRVFTVKPKKPNSAVRKVARVRLSTGRSVTAYIPGIGHNAQEHAVV 117

  Fly   123 LCRVGRLQDVPGVKLKAVRGVYDLAHV 149
            |.|.||.||.|||:...||||||:|.|
pombe   118 LLRGGRAQDCPGVQYHVVRGVYDIAGV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 54/92 (59%)
SPAC4F8.06NP_593866.2 rpsL 39..161 CDD:235355 54/92 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I1710
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6848
Inparanoid 1 1.050 109 1.000 Inparanoid score I1586
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003097
OrthoInspector 1 1.000 - - oto100674
orthoMCL 1 0.900 - - OOG6_101451
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1260
SonicParanoid 1 1.000 - - X2071
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.