DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tko and rps2302

DIOPT Version :10

Sequence 1:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_596187.1 Gene:rps2302 / 2541369 PomBaseID:SPBP4H10.13 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:100 Identity:37/100 - (37%)
Similarity:59/100 - (59%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIP--GIGHNLQEHNIVLC-- 124
            |..|...|||:|::.:..:.|:||||.||||.|:| ..||::.|::|  |..:.:.|::.||.  
pombe    40 PFGGSSHAKGIVVEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPHDGCLNFVDENDEVLLSG 104

  Fly   125 --RVGRLQ-DVPGVKLKAVR----GVYDLAHVVKK 152
              |.|:.: |:|||:.|.|:    |:..|.|..|:
pombe   105 FGRKGKAKGDIPGVRFKVVKVAGVGLSALFHEKKE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 36/98 (37%)
rps2302NP_596187.1 PTZ00067 1..143 CDD:185422 37/99 (37%)

Return to query results.
Submit another query.