DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and Hlf

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_006247198.1 Gene:Hlf / 690286 RGDID:1582828 Length:296 Species:Rattus norvegicus


Alignment Length:365 Identity:74/365 - (20%)
Similarity:126/365 - (34%) Gaps:146/365 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VETPRKTPSPYQTSYSY----------GSGSPSA------SPT---SNLLYAAQMQQQQHQQQQQ 153
            :|.|.|.|...:.::|.          ||.||:.      .||   ..|.|.....|.::...::
  Rat    26 LENPLKLPLHPEDAFSKDRDKGKKLDDGSNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEE 90

  Fly   154 QQQQQQQLASLYPAFYYSNIKQEQATPTAAPPKVTPTANLLQTFAAASAAAAAAAAASSTNSPR- 217
            ...:.    .:.|:       ..|...:..||.:.|         |:|.|.:....:|...:|. 
  Rat    91 FLSEN----GIPPS-------PSQHDHSPHPPGLQP---------ASSTAPSVMDLSSRATAPLH 135

  Fly   218 ---PASNASTMQIDVLENPLSPAVEATTPTTSSSGE---AGKNT-RPFK--------AFPRDPLV 267
               |:.|.       ::||:.|            |:   |.:|| .|..        .:..||..
  Rat   136 PGIPSPNC-------MQNPIRP------------GQLLPANRNTPSPIDPDTIQVPVGYEPDPAD 181

  Fly   268 IAANFAATDVLLDNPRVERYTEYRKRVLEQIRSSNGGSRTVTNPKMRRTNSRSGSVNEGSSSNNN 332
            :|.:......:.| ||..:::|...:....|:.    :|.|..|                   ::
  Rat   182 LALSSIPGQEMFD-PRKRKFSEEELKPQPMIKK----ARKVFIP-------------------DD 222

  Fly   333 SESEDRAAAEESSDCDSQAGNFESKSATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAA 397
            .:.:|:                                                |:.||||||.|
  Rat   223 LKQDDK------------------------------------------------YWARRRKNNMA 239

  Fly   398 AKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQL 437
            ||:|||.||:||::|||||::||::|..|..::..|:.:|
  Rat   240 AKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKEL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 28/55 (51%)
coiled coil 384..440 CDD:269843 28/54 (52%)
HlfXP_006247198.1 bZIP_HLF 226..284 CDD:269843 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.