DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and ddit3

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_005166228.1 Gene:ddit3 / 561924 ZFINID:ZDB-GENE-070410-90 Length:242 Species:Danio rerio


Alignment Length:276 Identity:64/276 - (23%)
Similarity:92/276 - (33%) Gaps:87/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PPKVTPTANL--------LQTFAAASAAAAAAAAASSTNSPRPASNASTMQIDVLENPLSPAVEA 240
            ||.|.|....        ||....:.     ...|..|.:| |:|......:|||        |:
Zfish     8 PPGVGPLCGAELEAWYEDLQDILGSD-----TGGAKLTRAP-PSSEKEPEFLDVL--------ES 58

  Fly   241 TTPTTSSSGEA-GKNTRPFKAFPRDPLVIAANFAATDVLLDNPRVERYTEYRKRVLEQIRSSNGG 304
            .:.|..:.|:. |...   :....||          .|....||.|..|           :.|..
Zfish    59 CSLTWLTEGQVWGDGV---QRVTEDP----------PVHQSPPRQEERT-----------TENTS 99

  Fly   305 SRTVTNPKMRRTNSRSG----SVNEGSS-------SNNNSESEDRAAAEESSDCDSQAGNFESKS 358
            |..:..|:.....|..|    .||.|:.       |...||.|:.....::|.|          |
Zfish   100 SGDLLPPEFFELLSEGGVGDTMVNGGAGYHLHAPPSPAASEEEELPTVPDTSSC----------S 154

  Fly   359 ATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAA------AKKSRDRRRIKEDEIAIRAA 417
            :.|.|.:|..:..|:..:||          .|:||...|      .|||| |.|.:|:|..::. 
Zfish   155 SASRSPSLNCSPPASPPVSS----------SRKRKRGGALCSASPGKKSR-REREQENERKVQE- 207

  Fly   418 YLERQNIELLCQIDAL 433
             |..||..|..:|:.|
Zfish   208 -LTDQNERLKAEIERL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 18/57 (32%)
coiled coil 384..440 CDD:269843 18/56 (32%)
ddit3XP_005166228.1 bZIP <204..235 CDD:304365 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.