DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and hlfb

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_005156391.1 Gene:hlfb / 557886 ZFINID:ZDB-GENE-110420-3 Length:300 Species:Danio rerio


Alignment Length:356 Identity:75/356 - (21%)
Similarity:122/356 - (34%) Gaps:133/356 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DLSRRCDSVETPRKT----PSPYQTSYSYGSG-------------SPSASPTSNLLYAAQMQQQQ 147
            |..::.|....|.::    |:.:..:.||...             |.:..|:|...:...:.|..
Zfish    43 DKVKKLDEEGNPPQSAFLGPTLWDKTLSYDGDSFQLEYMDLEEFLSENGIPSSPAQHDQNLHQHH 107

  Fly   148 HQQQQQQQQQQQQLASLYPAFYYSNIK-QEQATPTAAPPKVTPTANLLQTFAAASAAAAAAAAAS 211
            ||||||||.||||.....|....|.:. ..::..||..|:     |.|.       :...:....
Zfish   108 HQQQQQQQHQQQQQQVSMPQGPISVMDLSSRSIHTAISPQ-----NCLH-------SPGRSVLPP 160

  Fly   212 STNSPRPASNASTMQIDVLENPLSPAVEATTPTTSSSGEAGKNTRPFKAFPRDPLVIAANFAATD 276
            |.|:|.|      :..:.|..|:|                         :..||..:|.:.....
Zfish   161 SRNTPSP------VDPEALHIPVS-------------------------YEPDPADLALSSVPGQ 194

  Fly   277 VLLDNPRVERYTEYRKRVLEQIRSSNGGSRTVTNPKMRRTNSRSGSVNEGSSSNNNSESEDRAAA 341
            .:.| ||..:::|...:....|:.    :|.:..|...:                          
Zfish   195 EVFD-PRKRKFSEEELKPQPMIKK----ARKIFIPDDLK-------------------------- 228

  Fly   342 EESSDCDSQAGNFESKSATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAAAKKSRDRRR 406
                                                     :|..|:.||||||.|||:|||.||
Zfish   229 -----------------------------------------QDEKYWARRRKNNVAAKRSRDARR 252

  Fly   407 IKEDEIAIRAAYLERQNIELLCQIDALKVQL 437
            :||::|||||.:||::|:.|..::..|:.:|
Zfish   253 LKENQIAIRAGFLEKENMALRQEVADLRKEL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 29/55 (53%)
coiled coil 384..440 CDD:269843 29/54 (54%)
hlfbXP_005156391.1 bZIP_HLF 230..288 CDD:269843 29/54 (54%)
coiled coil 230..288 CDD:269843 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.