DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and nfil3

DIOPT Version :10

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001004120.1 Gene:nfil3 / 445509 ZFINID:ZDB-GENE-040822-28 Length:462 Species:Danio rerio


Alignment Length:61 Identity:24/61 - (39%)
Similarity:39/61 - (63%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 KDAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLAAFTSA 443
            ||..|:|||||||.|||:||::||:.:..:..:...|..:|..|..::.:||::....:||
Zfish    62 KDNLYWERRRKNNEAAKRSREKRRLNDMVLENKLMALGEENASLKAELLSLKLRFGLVSSA 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 22/56 (39%)
coiled coil 384..440 CDD:269843 21/55 (38%)
nfil3NP_001004120.1 bZIP_NFIL3 62..121 CDD:269842 22/58 (38%)
coiled coil 63..121 CDD:269842 21/57 (37%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 69..85 11/15 (73%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 91..112 3/20 (15%)
Vert_IL3-reg_TF 120..452 CDD:368956 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..210
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.