DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and tefa

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_005156192.1 Gene:tefa / 30674 ZFINID:ZDB-GENE-990415-264 Length:306 Species:Danio rerio


Alignment Length:277 Identity:68/277 - (24%)
Similarity:100/277 - (36%) Gaps:102/277 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KVTPTANLLQTFAAASAAAAAAAAASSTNSPRPASNASTMQIDVLENPLSPAVEATTPTTSSSGE 250
            |.:...|:..|....|.|:|...|.:.|..|       .|.:|..|.      |..|.|||||..
Zfish   103 KSSEKENIQLTAEEPSTASAVKTAPAVTLLP-------VMALDPCEE------EVVTITTSSSSS 154

  Fly   251 AGKNTRPFKAFP----RDPLVIAANFA--ATDVLLD--------NPRVERYTEYRKRVLEQIRSS 301
            |...:...:..|    .|.:.:..||.  .||::|.        :||..|::|...:....|:. 
Zfish   155 ADNKSEENRMTPDPINPDEIEVDVNFEPDPTDLVLSSIPGGELFDPRKHRFSEEELKPQPMIKK- 218

  Fly   302 NGGSRTVTNPKMRRTNSRSGSVNEGSSSNNNSESEDRAAAEESSDCDSQAGNFESKSATSSSSNL 366
               ::.|..|                        ||:                            
Zfish   219 ---AKKVFVP------------------------EDQ---------------------------- 228

  Fly   367 ANATAANSGISSGSQVKDAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQID 431
                            ||..|::||:|||.|||:|||.||:||::|.:|||:|||:|..|..::.
Zfish   229 ----------------KDDKYWQRRKKNNVAAKRSRDARRLKENQITVRAAFLERENSALRQEVA 277

  Fly   432 ALKVQLAAFTSAKVTTA 448
            .|:..   |...|.|.|
Zfish   278 ELRKD---FGRCKNTVA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 28/56 (50%)
coiled coil 384..440 CDD:269843 27/55 (49%)
tefaXP_005156192.1 bZIP_HLF 229..288 CDD:269843 29/61 (48%)
coiled coil 230..288 CDD:269843 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.