DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and Hlf

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_006533067.1 Gene:Hlf / 217082 MGIID:96108 Length:296 Species:Mus musculus


Alignment Length:55 Identity:29/55 - (52%)
Similarity:43/55 - (78%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 KDAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQL 437
            :|..|:.||||||.|||:|||.||:||::|||||::||::|..|..::..|:.:|
Mouse   225 QDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKEL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 29/55 (53%)
coiled coil 384..440 CDD:269843 29/54 (54%)
HlfXP_006533067.1 bZIP_HLF 226..284 CDD:269843 29/54 (54%)
coiled coil 226..284 CDD:269843 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.