DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and zip-6

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001255548.1 Gene:zip-6 / 187691 WormBaseID:WBGene00011130 Length:271 Species:Caenorhabditis elegans


Alignment Length:204 Identity:43/204 - (21%)
Similarity:67/204 - (32%) Gaps:47/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 SPAVEATTPTTSSSGEAGKNTRPFKA---FPRDPLVIAANFAATDVLLDNPRVERYTEYRKRVLE 296
            :|..:...|...|:........|..:   :|.||     ||..||   .:..|..:.:.|.....
 Worm    49 NPRYQGNVPGRGSNFSMNPAANPMSSQHQYPYDP-----NFYPTD---QSSHVPHHCDQRNHYFY 105

  Fly   297 QIRSSNGGSRTV-TNPKMRRT-NSRSGSVNEGSSSNNNSESEDRAAAEESSDCDSQAGNFESKSA 359
                   |:.|: ..|.|... |......:.........:||....|..|.|...:...:|..| 
 Worm   106 -------GNVTIKEEPYMSNVLNHDDDQTHISDEGFGEEDSEMHTGALPSIDTPKKERKYEKVS- 162

  Fly   360 TSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAAAKKSRDRRRIKED------EIAIRAAY 418
                                ...||..|..:|.|||.|.|:.|::::.:|.      |..||:..
 Worm   163 --------------------EDQKDEKYSSKREKNNLAVKRCREKKKNEEKYKKEAFENLIRSNL 207

  Fly   419 LERQNIELL 427
            ::.|.||.|
 Worm   208 VKDQKIEQL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 18/51 (35%)
coiled coil 384..440 CDD:269843 17/50 (34%)
zip-6NP_001255548.1 Peptidase_S6 <86..>157 CDD:367071 14/80 (18%)
bZIP 166..>185 CDD:389750 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.