DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and zip-7

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_502961.1 Gene:zip-7 / 178459 WormBaseID:WBGene00013100 Length:185 Species:Caenorhabditis elegans


Alignment Length:87 Identity:33/87 - (37%)
Similarity:52/87 - (59%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 SKSATSSSSNLANATAANSGISSGSQV------KDAAYYERRRKNNAAAKKSRDRRRIKEDEIAI 414
            |.|:|||:::..|..:.:||......|      ||.||.:|||:||.||:|||:.|:..:.:.::
 Worm    69 SSSSTSSTTSSQNQQSGSSGSKKKKPVPVPENQKDEAYLDRRRRNNEAARKSRESRKKVDQDNSV 133

  Fly   415 RAAYLERQNIELLCQIDALKVQ 436
            |..||||:|..|...:..|::|
 Worm   134 RVTYLERENQCLRVYVQQLQLQ 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 24/54 (44%)
coiled coil 384..440 CDD:269843 23/53 (43%)
zip-7NP_502961.1 bZIP 102..161 CDD:389750 24/54 (44%)
coiled coil 103..161 CDD:269834 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.