DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and ces-2

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_493610.1 Gene:ces-2 / 173365 WormBaseID:WBGene00000469 Length:211 Species:Caenorhabditis elegans


Alignment Length:104 Identity:42/104 - (40%)
Similarity:66/104 - (63%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 AGNFESKSATSSSSNLANATAANS---GISSGSQVKDAAYYERRRKNNAAAKKSRDRRRIKEDEI 412
            |....|:|:|.|||:.::...:.|   .:....:.||:||:|||||||.|||:|||.||.||::|
 Worm    80 ASPVSSRSSTVSSSHFSSPQRSPSRKMSVPIPEEKKDSAYFERRRKNNDAAKRSRDARRQKEEQI 144

  Fly   413 AIRAAYLERQNIELLCQIDALK---VQLAAFTSAKVTTA 448
            |.:|..|||:|::|..::.:|:   .||.....:|::.|
 Worm   145 ASKAHALERENMQLRGKVSSLEQEAAQLRFLLFSKISPA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 32/59 (54%)
coiled coil 384..440 CDD:269843 31/58 (53%)
ces-2NP_493610.1 bZIP_HLF 115..173 CDD:269843 31/57 (54%)
coiled coil 116..173 CDD:269843 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14132
orthoMCL 1 0.900 - - OOG6_110152
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.