DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and cebpb

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_571959.2 Gene:cebpb / 140814 ZFINID:ZDB-GENE-020111-3 Length:280 Species:Danio rerio


Alignment Length:145 Identity:35/145 - (24%)
Similarity:62/145 - (42%) Gaps:40/145 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 GSSSNNNSESEDRAAAEESSDCDSQAGNFESKS----ATSSSSNLANATAANSGISS-------- 378
            ||.:.:|...|:       :..|. .|.::.:|    .|:.|.:|.|.:.|:|..||        
Zfish   132 GSFAKSNGRHEE-------TPMDG-PGGYDMRSYLPYQTAPSGSLGNISTASSSCSSPPGTPAPS 188

  Fly   379 --------GSQV-----------KDA-AYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQN 423
                    |.::           ||: .|.:||.:||.|.:||||:.:::..|...:...|..:|
Zfish   189 GKGRSPQAGGKMTSSGKGKKRLDKDSDEYRQRRERNNLAVRKSRDKAKMRNLETQHKVLELAAEN 253

  Fly   424 IELLCQIDALKVQLA 438
            ..|..:::.|..:||
Zfish   254 DRLQKRVEQLSRELA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 19/57 (33%)
coiled coil 384..440 CDD:269843 18/56 (32%)
cebpbNP_571959.2 bZIP_CEBPB 207..277 CDD:269860 19/62 (31%)
coiled coil 214..275 CDD:269860 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.