DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and Cebpg

DIOPT Version :10

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_034014.1 Gene:Cebpg / 12611 MGIID:104982 Length:150 Species:Mus musculus


Alignment Length:52 Identity:18/52 - (34%)
Similarity:28/52 - (53%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 YYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLA 438
            |.:||.:||.|.||||.:.:.|..:...|...|:.:|..|..:|..|..:|:
Mouse    65 YRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 18/52 (35%)
coiled coil 384..440 CDD:269843 18/52 (35%)
CebpgNP_034014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 11/28 (39%)
bZIP_CEBPG 60..120 CDD:269861 18/52 (35%)
coiled coil 62..120 CDD:269861 18/52 (35%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..150
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.