DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and Cebpd

DIOPT Version :10

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_031705.3 Gene:Cebpd / 12609 MGIID:103573 Length:268 Species:Mus musculus


Alignment Length:81 Identity:24/81 - (29%)
Similarity:40/81 - (49%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SSSSNLANATAANSGISSGSQVKDAA---YYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQ 422
            |...:||..|....|  :|.:..|..   |.:||.:||.|.:||||:.:.:..|:..:...|..:
Mouse   167 SPGPSLAPGTVREKG--AGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAE 229

  Fly   423 NIELLCQIDALKVQLA 438
            |.:|..:::.|...||
Mouse   230 NEKLHQRVEQLTRDLA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 18/59 (31%)
coiled coil 384..440 CDD:269843 18/58 (31%)
CebpdNP_031705.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..132
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..219 17/53 (32%)
bZIP_CEBPD 188..252 CDD:269862 18/58 (31%)
coiled coil 191..249 CDD:269862 17/55 (31%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.