DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and Nfil3

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_446179.2 Gene:Nfil3 / 114519 RGDID:620972 Length:462 Species:Rattus norvegicus


Alignment Length:139 Identity:36/139 - (25%)
Similarity:65/139 - (46%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 KMRRTNSRSGSVNEGSSSNN----NSE----SEDRAAAEESSDCDSQAGNFESKSATSSSSNLAN 368
            ||:.......|::...||:.    ||.    :||.|:.|:....:...|..:|.:.......:.:
  Rat     5 KMQAIKKEPASLDPTGSSDKMLLLNSALAEVAEDLASGEDLLLNEGSMGKNKSSACRRKREFIPD 69

  Fly   369 ATAANSGISSGSQVKDAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDAL 433
                        :.|||.|:|:|||||.|||:||::||:.:..:..:...|..:|..|..::.:|
  Rat    70 ------------EKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSL 122

  Fly   434 KVQLAAFTS 442
            |::....:|
  Rat   123 KLKFGLISS 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 22/56 (39%)
coiled coil 384..440 CDD:269843 21/55 (38%)
Nfil3NP_446179.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/16 (19%)
bZIP_NFIL3 72..131 CDD:269842 22/58 (38%)
coiled coil 76..127 CDD:269842 19/50 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..95 10/15 (67%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 99..106 0/6 (0%)
Vert_IL3-reg_TF 130..461 CDD:368956 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.