DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and NFILZ

DIOPT Version :10

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001365528.1 Gene:NFILZ / 105372267 HGNCID:52681 Length:289 Species:Homo sapiens


Alignment Length:54 Identity:25/54 - (46%)
Similarity:37/54 - (68%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 KDAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQ 436
            ||..|:|:|||||.|||:||::||:.:..|..|.|.|..:|..|..::.|||::
Human    41 KDTVYWEKRRKNNEAAKRSREKRRLNDAAIEGRLAALMEENALLKGELKALKLR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 25/54 (46%)
coiled coil 384..440 CDD:269843 24/53 (45%)
NFILZNP_001365528.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
bZIP_NFIL3 41..98 CDD:269842 25/54 (46%)
coiled coil 42..98 CDD:269842 24/53 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 48..64 10/15 (67%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 70..91 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.