DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and CEBPE

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:239 Identity:56/239 - (23%)
Similarity:85/239 - (35%) Gaps:62/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 ENPLSPAVEATTPTTSSSGEAGKNTRPFKAFPRDPLVIAANFAATDVLLDNPRVERYTEY----- 290
            |..|...:.|..|...:.|..|..|   .|||.             .|..:||...|..:     
Human    50 EEQLLSDLFAVKPAPEARGLKGPGT---PAFPH-------------YLPPDPRPFAYPPHTFGPD 98

  Fly   291 RKRVLEQIRSSNGGSRTVTNPKMRRTNSRSGSVNEGSSSNNNSESEDRAAAE----ESSDCDSQA 351
            ||.:...|.||.|.           .:.|:.:|.|.......|.:..|.:..    :.:.|...|
Human    99 RKALGPGIYSSPGS-----------YDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTA 152

  Fly   352 GN--------------FESKSATSS--SSNLANATAANSGISSGSQV--KDAAYYE-RRRKNNAA 397
            .:              .::..||::  .|.|..|.:....:..|.:.  ||:..|. ||.:||.|
Human   153 MHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIA 217

  Fly   398 AKKSRD--RRRIKEDEIAIRAAYLE----RQNIELLCQ-IDALK 434
            .:||||  :|||.|.:..:.....|    |..:|.|.| :|.|:
Human   218 VRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 23/60 (38%)
coiled coil 384..440 CDD:269843 22/59 (37%)
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PHA03247 <62..192 CDD:223021 29/156 (19%)
bZIP_CEBPE 202..262 CDD:269863 23/60 (38%)
coiled coil 207..258 CDD:269863 19/50 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.