DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gt and CEBPD

DIOPT Version :9

Sequence 1:NP_525049.1 Gene:gt / 31227 FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_005186.2 Gene:CEBPD / 1052 HGNCID:1835 Length:269 Species:Homo sapiens


Alignment Length:100 Identity:27/100 - (27%)
Similarity:44/100 - (44%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 AAAEESSDCDSQAGNFESKSATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAAAKKSRD 403
            |||.:.:...|......|...|.:.......:|...|...||    ..|.:||.:||.|.:||||
Human   150 AAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGS----PEYRQRRERNNIAVRKSRD 210

  Fly   404 RRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLA 438
            :.:.:..|:..:...|..:|.:|..:::.|...||
Human   211 KAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 16/55 (29%)
coiled coil 384..440 CDD:269843 16/54 (30%)
CEBPDNP_005186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..219 19/71 (27%)
bZIP_CEBPD 188..252 CDD:269862 18/61 (30%)
coiled coil 191..249 CDD:269862 17/58 (29%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.