DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12496 and CG15646

DIOPT Version :9

Sequence 1:NP_570003.1 Gene:CG12496 / 31226 FlyBaseID:FBgn0040385 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001285281.1 Gene:CG15646 / 32501 FlyBaseID:FBgn0030665 Length:410 Species:Drosophila melanogaster


Alignment Length:316 Identity:87/316 - (27%)
Similarity:133/316 - (42%) Gaps:101/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKWTASAQR----LNEIPVHDQDANQ-------------------PQRRRLQRRQRRQRRATIA 42
            ||||..:..|    ..|:.:..|..::                   .:...|:.:.:|:......
  Fly     1 MLKWAVNQPRNSYLAKELAMGSQTGSESGSGSGSLEQKAEVVGSSYSEFHALRGKLKRKSIGVAP 65

  Fly    43 NKENVPDTVGYTSTPVPITRL---RNSPLVLAPLSDIRNV--TPEAVVRSQAP-----QRVQSVR 97
            .|||     ..||||:|.:.|   ..:||    |.|:.|:  ||.:...|.|.     .....::
  Fly    66 GKEN-----QLTSTPLPASSLSLHARTPL----LKDLSNILATPPSGGASGASGATGGAAAVPLK 121

  Fly    98 YATTLPRFAEDYSPNG--LPSGQHLALRGLAPLDPFLGQPRYIVGSGAGVNKLKQRRLDEDFVAT 160
            :|.|||.|..:||||.  :| |..:||||:...|.:..:|||                       
  Fly   122 FACTLPTFEAEYSPNAAIIP-GSLIALRGMGIPDSYFEKPRY----------------------- 162

  Fly   161 LEPELQETAVPEP-PTPKVEVRPSTP-----QPASTQMGDQTLDRLIDAILDSACKA--NASSK- 216
                |::..:|.| |.|    .|:.|     ..:|:||||.||:|:|||||:|..|.  ||..: 
  Fly   163 ----LEQKPLPHPHPHP----HPAPPIGEQNTLSSSQMGDVTLERMIDAILESNRKVLPNARQQQ 219

  Fly   217 -----KKPRRSTFNLRRRTLVKQQM--------ESNCPQEVLSPSYAPGDDPASDL 259
                 ::||:   :||:|..::||:        ..:...:..||:|.|..||||||
  Fly   220 HQHQHRQPRQ---HLRQRHRLRQQVLRSSHGHGHGHGSTQTPSPTYRPAFDPASDL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12496NP_570003.1 DUF4799 54..>280 CDD:292674 75/240 (31%)
CG15646NP_001285281.1 DUF4799 53..401 CDD:292674 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F87Z
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016800
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.