DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PsGEF and Rph3al

DIOPT Version :10

Sequence 1:NP_996333.4 Gene:PsGEF / 31224 FlyBaseID:FBgn0264598 Length:2777 Species:Drosophila melanogaster
Sequence 2:NP_083824.1 Gene:Rph3al / 380714 MGIID:1923492 Length:302 Species:Mus musculus


Alignment Length:141 Identity:38/141 - (26%)
Similarity:54/141 - (38%) Gaps:35/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2090 PPLVPRPVVPDREEDPSAE---------GQQENLAMEDQEDLHSS--VERLLPNLATSAMGPRP- 2142
            |...|.||.|...:.||||         |:..:...:...||.||  .:|.||:......|.:| 
Mouse   175 PHFRPLPVEPTETQPPSAETSRVYTWARGRVVSSDSDSDSDLSSSSLEDRPLPSGVKGTKGDKPR 239

  Fly  2143 ------LLTTRLLPTTAIDPQPPAVLVASSCEYLLDQRPSSVPGRDLAGGSIGTTTMTSSRPTPL 2201
                  :.:.||.|.     :||:.|..|.         ||: |.:...|:......|.::|.|.
Mouse   240 GDSGASMESPRLGPA-----RPPSHLSGSQ---------SSL-GSEAGTGATEPQGGTPAQPEPR 289

  Fly  2202 SPAK--AAATP 2210
            .|.|  ..|||
Mouse   290 VPGKRHTWATP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PsGEFNP_996333.4 DUF4799 <99..209 CDD:318308
C2 286..>381 CDD:425499
PDZ_canonical 645..716 CDD:483948
RhoGEF 835..1007 CDD:470622
PRK12323 <2304..>2415 CDD:481241
Rph3alNP_083824.1 FYVE_2 45..159 CDD:426716
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..302 38/141 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.