DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PsGEF and Rph

DIOPT Version :9

Sequence 1:NP_996333.4 Gene:PsGEF / 31224 FlyBaseID:FBgn0264598 Length:2777 Species:Drosophila melanogaster
Sequence 2:NP_572651.1 Gene:Rph / 32002 FlyBaseID:FBgn0030230 Length:638 Species:Drosophila melanogaster


Alignment Length:294 Identity:62/294 - (21%)
Similarity:109/294 - (37%) Gaps:68/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EMEVRTP-THLKRQRVVRRKNPHKTTTINQTQSHQAKKLEPLQLVPSTKRCLSFSSSSASSDLDE 226
            ::.:.|| .|.|..|..|.|..|||......::.|...:||.:|..|......|.......|.  
  Fly   394 KLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGHDF-- 456

  Fly   227 DEQQVAKRSSLASPTTTPPSHCTTTTSSISSSSSS---------NGGADMEAS-QRGSIDVSIAF 281
                      |.:...     |.:|..|.|....|         :..|:|..: ..|.:.:|:.:
  Fly   457 ----------LGAAKV-----CLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNWPNGKMLLSLCY 506

  Fly   282 DAKEQQLNVHVIRCRDLQRSHGSGNGSINAYVKVALSGGAQPPGYGGHSSGGSMSSGYQRTAVHR 346
            :.|.:.|.|:|.:|.:|...  ..|||.:.:||:.|...|.             .:...:|:|..
  Fly   507 NTKRRALVVNVKQCINLMAM--DNNGSSDPFVKIQLKPDAH-------------KNKKHKTSVKW 556

  Fly   347 HSGRPYFDQRFNFQISSGEETAGQYLQLAVWHRDRHLNSVPVTQSEWQARVKSGTERRTAERLAK 411
            .:..|.:::.|.|: :|..:...:.|.|.||.:|..      ..:::...::.|.:.: .|||  
  Fly   557 RTLNPIYNEEFYFE-ASPHDLNKEMLILTVWDKDLG------KSNDFLGSLQLGAQSK-GERL-- 611

  Fly   412 LENAGNEAKRSEFLGCSTFP--LNELVH---PDS 440
                      .::|.|...|  .:|..|   ||:
  Fly   612 ----------QQWLDCIRLPDHFHEKWHCLAPDN 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PsGEFNP_996333.4 DUF4799 <102..209 CDD:292674 14/46 (30%)
C2 286..>381 CDD:278593 22/94 (23%)
PDZ_signaling 644..716 CDD:238492
RhoGEF 831..1000 CDD:295373
RphNP_572651.1 PHD_SF 84..172 CDD:304600
C2A_Rabphilin_Doc2 354..477 CDD:176000 22/99 (22%)
C2B_Rabphilin_Doc2 499..631 CDD:176030 34/166 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1013
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.