DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and RPL23

DIOPT Version :10

Sequence 1:NP_525048.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_000969.1 Gene:RPL23 / 9349 HGNCID:10316 Length:140 Species:Homo sapiens


Alignment Length:72 Identity:15/72 - (20%)
Similarity:35/72 - (48%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NKRGVGFIGDKVLVAI---KGQMKKGI--LVGLKQNQKPKQPK-----FDSNNLVLIDDNGSPLG 124
            |:.....:||.|:..:   |.:::|.:  .|.::|.:..::..     |:.|..|::::.|...|
Human    50 NRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKG 114

  Fly   125 TRIHVPI 131
            :.|..|:
Human   115 SAITGPV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_525048.1 Ribosomal_uL14 39..136 CDD:466774 15/72 (21%)
RPL23NP_000969.1 PTZ00054 2..139 CDD:185418 15/72 (21%)

Return to query results.
Submit another query.