DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and RPL23B

DIOPT Version :10

Sequence 1:NP_525048.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_011042.3 Gene:RPL23B / 856853 SGDID:S000000919 Length:137 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:14/72 - (19%)
Similarity:30/72 - (41%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NKRGVGFIGDKVLVAI---KGQMKKGILVGLKQNQKPKQPK-------FDSNNLVLIDDNGSPLG 124
            |:.....:||.|:..:   |.:::|.::..:...|.....:       |:.|..|:.:..|...|
Yeast    47 NRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKG 111

  Fly   125 TRIHVPI 131
            :.|..|:
Yeast   112 SAITGPV 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_525048.1 Ribosomal_uL14 39..136 CDD:466774 14/72 (19%)
RPL23BNP_011042.3 PTZ00054 5..137 CDD:185418 14/72 (19%)

Return to query results.
Submit another query.