DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and HLL

DIOPT Version :9

Sequence 1:NP_001259186.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_173200.1 Gene:HLL / 838332 AraportID:AT1G17560 Length:196 Species:Arabidopsis thaliana


Alignment Length:161 Identity:41/161 - (25%)
Similarity:69/161 - (42%) Gaps:62/161 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LRVVDNSDLGKKAMAEGRPPRCIH-VYNKRGVGFIGDKVLVAI-----------------KGQMK 90
            |:.|||| ..|:.|       ||. :..|:|.. :||.::.::                 ||::|
plant    55 LKCVDNS-CAKEVM-------CIQSLRGKKGAR-LGDIIVGSVKEANPIVQKKVKKDAIPKGKVK 110

  Fly    91 KGILV-GL-------KQNQKPKQPKFDSNNLVLI---------DDNGS--------PLGTRIHVP 130
            ||::| |:       |......|.|||.|.:|::         :.:||        |.|||:..|
plant   111 KGMVVYGVVVRAAMPKGRADGSQVKFDDNAIVVVGIKEKKGQNNSHGSKRKMEYNQPTGTRVFGP 175

  Fly   131 IPTILRTILKEKTLAKGADYTKVLAIASRYV 161
            :|..:|  |:::        .|:|::|...|
plant   176 VPHEMR--LRKQ--------LKILSLAQHIV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 40/157 (25%)
HLLNP_173200.1 Ribosomal_L14 50..195 CDD:395182 40/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1547267at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.