DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and mrpl14

DIOPT Version :9

Sequence 1:NP_001259186.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_957441.1 Gene:mrpl14 / 394122 ZFINID:ZDB-GENE-040426-1066 Length:141 Species:Danio rerio


Alignment Length:151 Identity:74/151 - (49%)
Similarity:96/151 - (63%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LAVTLGG-----QQTQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVG 75
            :|::|.|     ...|:....:.|...|:||.|:||||||.||.  ....|||:.||||||.|||
Zfish     1 MALSLSGLILPKLMQQRAFSVSSAVSAIQKLTRVRVVDNSTLGN--AHHHRPPKVIHVYNKNGVG 63

  Fly    76 FIGDKVLVAIKGQMKKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILK 140
            .:||:||:|||||.||.|:||.|.......|:|||||:|||:|||:|.||||..|:||.||.:  
Zfish    64 KVGDRVLLAIKGQKKKAIIVGHKMPGARMTPRFDSNNVVLIEDNGNPTGTRIKAPLPTHLRKL-- 126

  Fly   141 EKTLAKGADYTKVLAIASRYV 161
                  ..:|:|:||||.|:|
Zfish   127 ------EGEYSKLLAIAQRFV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 67/120 (56%)
mrpl14NP_957441.1 Ribosomal_L14 28..140 CDD:294234 67/121 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593623
Domainoid 1 1.000 120 1.000 Domainoid score I5727
eggNOG 1 0.900 - - E1_KOG3441
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12268
Inparanoid 1 1.050 131 1.000 Inparanoid score I4613
OMA 1 1.010 - - QHG48481
OrthoDB 1 1.010 - - D1547267at2759
OrthoFinder 1 1.000 - - FOG0005521
OrthoInspector 1 1.000 - - oto38868
orthoMCL 1 0.900 - - OOG6_108936
Panther 1 1.100 - - LDO PTHR21037
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3812
SonicParanoid 1 1.000 - - X3941
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.