DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and RpL23

DIOPT Version :10

Sequence 1:NP_525048.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_523813.1 Gene:RpL23 / 37628 FlyBaseID:FBgn0010078 Length:140 Species:Drosophila melanogaster


Alignment Length:73 Identity:16/73 - (21%)
Similarity:37/73 - (50%) Gaps:12/73 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NKRGVGFIGDKVLVAI---KGQMKKGIL--VGLKQNQKPKQPK------FDSNNLVLIDDNGSPL 123
            |:.....:||..:..:   |.:::|.::  |.::| :||.:.:      |:.|..|::::.|...
  Fly    50 NRLPAAGVGDMFVATVKKGKPELRKKVMPAVVIRQ-RKPFRRRDGVFIYFEDNAGVIVNNKGEMK 113

  Fly   124 GTRIHVPI 131
            |:.|..|:
  Fly   114 GSAITGPV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_525048.1 Ribosomal_uL14 39..136 CDD:466774 16/73 (22%)
RpL23NP_523813.1 PTZ00054 2..139 CDD:185418 16/73 (22%)

Return to query results.
Submit another query.