DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL14 and rpl23

DIOPT Version :10

Sequence 1:NP_525048.1 Gene:mRpL14 / 31222 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_957026.1 Gene:rpl23 / 336812 ZFINID:ZDB-GENE-030131-8756 Length:140 Species:Danio rerio


Alignment Length:65 Identity:14/65 - (21%)
Similarity:33/65 - (50%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IGDKVLVAI---KGQMKKGI--LVGLKQNQKPKQPK-----FDSNNLVLIDDNGSPLGTRIHVPI 131
            :||.|:..:   |.:::|.:  .|.::|.:..::..     |:.|..|::::.|...|:.|..|:
Zfish    57 VGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPV 121

  Fly   132  131
            Zfish   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL14NP_525048.1 Ribosomal_uL14 39..136 CDD:466774 14/65 (22%)
rpl23NP_957026.1 PTZ00054 2..139 CDD:185418 14/65 (22%)

Return to query results.
Submit another query.